PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn344741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 1444aa    MW: 163648 Da    PI: 5.3059
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn344741genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.52e-172479257
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                 kR+  t++qle+Le++++ + yp +++r+eL++kl+L++rq + WF+ rR k+kk
  Achn344741 24 PKRQMKTPYQLEILEKAYALETYPLEATRAELSEKLRLSDRQLQLWFCHRRLKDKK 79
                69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-18580IPR009057Homeodomain-like
SuperFamilySSF466893.08E-151479IPR009057Homeodomain-like
PROSITE profilePS5007115.7422080IPR001356Homeobox domain
SMARTSM003891.6E-162284IPR001356Homeobox domain
PfamPF000464.3E-152479IPR001356Homeobox domain
CDDcd000868.90E-132580No hitNo description
PROSITE patternPS0002705578IPR017970Homeobox, conserved site
SMARTSM005717.7E-23532591IPR018501DDT domain
PROSITE profilePS5082716.416532591IPR018501DDT domain
PfamPF027919.8E-18533588IPR018501DDT domain
PfamPF050664.1E-12714779IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.3E-10896940IPR028942WHIM1 domain
PfamPF156131.0E-139681039IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1444 aa     Download sequence    Send to blast
MEAGSEGENN KNSDESPIEG PKKPKRQMKT PYQLEILEKA YALETYPLEA TRAELSEKLR  60
LSDRQLQLWF CHRRLKDKKH LGAKKPKDAG GVEKKGLFDP ARDELMAAER GSNHGSKSGS  120
GSGSGSGLGW SRFDERDDVP IVRRYYESPE SVMEQRVIAC VEAQLGEPLR EDGPILGMDF  180
DELPPGAFGE PIGRDRSSDL NDILIYSRIR KLIAATRGHR ECLLDEPENR SDVYERLIPS  240
NFYDQPVECP SASAPLLRHG YGQVSRGYEV QGQASCPSLS THQGKEGLFS SPSGDNNCIS  300
ERESLINMKM NAPDNLQPAG VPDNIDASDR HISNSESGLR MEKKRKSNEA RIGSQVDAQE  360
KRIRKELEKQ DIMRRKREEE QMRREMEKQN RERRKDEERM VREKQRQQER FEREEKRENE  420
RREKFLQKEL LKAERRRQKE ELRREKEEAR LKASIERATT RQIARESMEL IEDERLELME  480
LATSSKGLPS IISLDYDTLQ NLESFRGFLC SFPPKAVQLK RPFSVQPWTD SEENIGNLLM  540
VWRFCITFAD VLGLWPFTLD EFVQAFHDYD SRLLGEIHIS LLKLIIKDIE DVARTPSNGI  600
CTNQCSSANP EGGHPQIVKG AYLWGFDIRN WKNHLNPLTW PEILRQFALS AAFGPQLKKK  660
IIKTAGFPDN DETKACQDII STLRNGSAAE NAVAIMQQKG FPLQRRSRHR LTPGTIKFAA  720
YHVLSLEGSK GMTVIELTHK IQKSGLRGLS TSKTPEASIS VALSRDAVLF ERTAPSTYRV  780
CTPFRKDPTD ADVIFSAARE KIKRYENGFL AGEIVDDVER DEDSEGQGAE GPEIYDLGIP  840
NANRNSNNEN EVGICSRNGT DHFLDDVTLN LQNEPDASDK GPNNPDQGDP EIDEGESGEL  900
WVQGLAEGEY SDLSVEERLK ALVTLVGIGN EGNSIRSVLE QNGYAAERRR LQLKSYVGHK  960
AEEMYTYRSL PLGQDRRLNR YWIFVASASS NDPGSGRIFL ESPDGFWRFI DSEEAFDALL  1020
ESLDTRGIRE SHLHIMLQNI EKSFKETIRK NSQCAIMVDR SGNIGREDAE MDCSPAQSGG  1080
ADSPSSTVSG SHTNTYEPSF SFGIELGKNA TEKKAAMERY QEFQKWMWKE CFNSSTLCAM  1140
KYGEKRCRPL LEICDFCLDS YKVESDLCPS CYRSFGAFDD QITLSEQCED KSKASPRNSL  1200
ISRFSHPLRF RLLRAMLTTI EKLQSTYAFM MNIEDTGKGK HRKEKNSTDL ASMRESYGYR  1260
QKGVFGLVRG RPQKRFIGFG RRNLSMSSIQ VRRQQGQRTH GQRFGRGWQT VRRRIEKSAV  1320
PETLLSHLGN TGGLKILDEL PRTSSGEEEN GGGEEIQQMQ IEEAVKSDAD DHIVEYEYEK  1380
WGTRNAMVMS DEDVDGSEDK NGFKEMREEN FEVDVDMNED SDGNSDGNEN GTADISDSEE  1440
FSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096357.10.0PREDICTED: uncharacterized protein LOC105175572 isoform X1
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA5B9110.0A5B911_VITVI; Putative uncharacterized protein
STRINGSolyc02g077660.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21422352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.20.0Homeodomain-like transcriptional regulator